Structure of PDB 8hku Chain L18P

Receptor sequence

>8hkuL18P (length=193) Species: 330779 (Sulfolobus acidocaldarius DSM 639)

TQGPNYRIKFRRRREGKTDYYTRYTYVINNAIRFVPRLTNKYVIVSVSKF
DQKGDIMIAYAHSIELVKKYGWKGDTNNTPAAYLTGYLAGLRAVKSGVKA
AVSDIGLFVPVKGGRIFAVIKGAIDAGLKVPVGDLGKLKDRVNGSHISAY
AQKLKNENQELYNKLFSSYIQRGLDPVLLPQHFEEVLNKIKEN

3D structure

• PDB: 8hku Cryo-EM Structures and Translocation Mechanism of Crenarchaeota Ribosome
• Chain: L18P
• Resolution: 2.72 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	L18P	P5 N6 Y7 K10 R14 T19 D20 Y22 T26 N30 V103 I106 V133 G134	P4 N5 Y6 K9 R13 T18 D19 Y21 T25 N29 V102 I105 V132 G133
BS02	rna	L18P	T2 G4 I9 F11 R12 R13 R15 T19 Y21 R24 R34 R38 T40 N41 K42 Y43 K54 D56 M58 Y61 D76 N79 T80 V110 V112 K113 G115 R116 R142 H147 Y151 Y163 N164 K165 L166 F167 Y170	T1 G3 I8 F10 R11 R12 R14 T18 Y20 R23 R33 R37 T39 N40 K41 Y42 K53 D55 M57 Y60 D75 N78 T79 V109 V111 K112 G114 R115 R141 H146 Y150 Y162 N163 K164 L165 F166 Y169

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0008097 5S rRNA binding
• GO:0019843 rRNA binding

Biological Process

• GO:0000027 ribosomal large subunit assembly
• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:8hku, PDBe:8hku, PDBj:8hku
• PDBsum: 8hku
• PubMed: 37604686
• UniProt: O05640|RL18_SULAC Large ribosomal subunit protein uL18 (Gene Name=rpl18)