Structure of PDB 8hku Chain L15P

Receptor sequence
>8hkuL15P (length=94) Species: 330779 (Sulfolobus acidocaldarius DSM 639) [Search protein sequence]
MHKEKWSWTVKFGEGWYGKHGFRNPTSKLVNAIGLRKLQEYIDKVVDLAK
YGYDKLLGGGNLRLPLVIKVAKATEKAKERVKEIGGEIILTSSE
3D structure
PDB8hku Cryo-EM Structures and Translocation Mechanism of Crenarchaeota Ribosome
ChainL15P
Resolution2.72 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 rna L15P K41 E42 W44 S45 W46 K49 G56 K57 H58 G59 F60 R61 N62 P63 T64 S65 R74 K105 L107 G108 G109 T124 K126 R130 K3 E4 W6 S7 W8 K11 G18 K19 H20 G21 F22 R23 N24 P25 T26 S27 R36 K55 L57 G58 G59 T74 K76 R80
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0015934 large ribosomal subunit
GO:0022625 cytosolic large ribosomal subunit
GO:0043232 intracellular non-membrane-bounded organelle
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:8hku, PDBe:8hku, PDBj:8hku
PDBsum8hku
PubMed37604686
UniProtO05643|RL15_SULAC Large ribosomal subunit protein uL15 (Gene Name=rpl15)

[Back to BioLiP]