Structure of PDB 8hkz Chain L15E

Receptor sequence

>8hkzL15E (length=169) Species: 330779 (Sulfolobus acidocaldarius DSM 639) [Search protein sequence]

SMYHYIEQTWQNKDWRRSILRKRLIEWRRQPAITRIDRPTRLNRARALGY
KAKQGFVMVRVRVRRGGLNKPRPNSGRRPKRMGVYGYGPSKGYRWIAEER
AARKFPNLEVLGSYYVAEDGMYKYYEVIMVDYSHPVIRSDPELKWLQDSV
NRKRVFRGLTSAGQKSRGL

3D structure

PDB

8hkz Cryo-electron microscopy structure and translocation mechanism of the crenarchaeal ribosome.

Chain

L15E

Resolution

4.78 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	L15E	S4 Y6 H7 Q14 N15 I28 R31 R32 R38 R41 R44 R47 R49 K54 A55 K56 Q57 R67 R68 L71 N72 K73 P74 R75 S78 R80 R81 P82 K83 R84 M85 G86 V87 Y88 G89 P92 S93 Y96 R103 R106 K107 F108 P109 N110 L111 Y118 G123 Y125 Y135 H137 P138 R141 S142 K156 F159 R160 L162 K168 S169 R170	S1 Y3 H4 Q11 N12 I25 R28 R29 R35 R38 R41 R44 R46 K51 A52 K53 Q54 R64 R65 L68 N69 K70 P71 R72 S75 R77 R78 P79 K80 R81 M82 G83 V84 Y85 G86 P89 S90 Y93 R100 R103 K104 F105 P106 N107 L108 Y115 G120 Y122 Y132 H134 P135 R138 S139 K153 F156 R157 L159 K165 S166 R167

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8hkz, PDBe:8hkz, PDBj:8hkz
PDBsum	8hkz
PubMed	37604686
UniProt	Q4JB20\|RL15E_SULAC Large ribosomal subunit protein eL15 (Gene Name=rpl15e)

[Back to BioLiP]