Structure of PDB 8hkv Chain L15E

Receptor sequence

>8hkvL15E (length=169) Species: 330779 (Sulfolobus acidocaldarius DSM 639) [Search protein sequence]

SMYHYIEQTWQNKDWRRSILRKRLIEWRRQPAITRIDRPTRLNRARALGY
KAKQGFVMVRVRVRRGGLNKPRPNSGRRPKRMGVYGYGPSKGYRWIAEER
AARKFPNLEVLGSYYVAEDGMYKYYEVIMVDYSHPVIRSDPELKWLQDSV
NRKRVFRGLTSAGQKSRGL

3D structure

PDB

8hkv Cryo-EM Structures and Translocation Mechanism of Crenarchaeota Ribosome

Chain

L15E

Resolution

4.94 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	L15E	S4 Y6 Q14 N15 I28 R31 R38 R41 L45 R47 R49 L51 K54 K56 Q57 R67 R68 G69 G70 L71 N72 K73 R75 S78 G79 R80 R81 P82 K83 R84 M85 G86 V87 Y88 G89 S93 K94 G95 I99 E102 R103 R106 K107 F108 P109 N110 L111 Y118 G123 K126 D134 Y135 V139 E145 K147 K156 R157 R160 S164 Q167 K168 R170	S1 Y3 Q11 N12 I25 R28 R35 R38 L42 R44 R46 L48 K51 K53 Q54 R64 R65 G66 G67 L68 N69 K70 R72 S75 G76 R77 R78 P79 K80 R81 M82 G83 V84 Y85 G86 S90 K91 G92 I96 E99 R100 R103 K104 F105 P106 N107 L108 Y115 G120 K123 D131 Y132 V136 E142 K144 K153 R154 R157 S161 Q164 K165 R167

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8hkv, PDBe:8hkv, PDBj:8hkv
PDBsum	8hkv
PubMed	37604686
UniProt	Q4JB20\|RL15E_SULAC Large ribosomal subunit protein eL15 (Gene Name=rpl15e)

[Back to BioLiP]