Structure of PDB 8hky Chain L14P

Receptor sequence
>8hkyL14P (length=134) Species: 330779 (Sulfolobus acidocaldarius DSM 639) [Search protein sequence]
MNVLGSRKGFTPALQHNSSVVVADNSGAKEAVIIGIYGYRGVLRRVPFAN
IADLVMVSVRKGSPDVRKQKFKAVIVRQRMPFRRPDGTWISFEDNAVVII
NPDGTPKGTEVRGPIAREAAERWPKIASVATMVI
3D structure
PDB8hky Cryo-EM Structures and Translocation Mechanism of Crenarchaeota Ribosome
ChainL14P
Resolution4.45 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 rna L14P M5 L8 G9 S10 R11 Q19 N21 S22 I38 I40 Y41 G42 R44 G45 V46 L47 R48 R49 V50 F52 M60 R64 K72 K74 R83 M84 R87 W93 M1 L4 G5 S6 R7 Q15 N17 S18 I34 I36 Y37 G38 R40 G41 V42 L43 R44 R45 V46 F48 M56 R60 K68 K70 R79 M80 R83 W89
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
GO:0070180 large ribosomal subunit rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:8hky, PDBe:8hky, PDBj:8hky
PDBsum8hky
PubMed37604686
UniProtQ4JB50|RL14_SULAC Large ribosomal subunit protein uL14 (Gene Name=rpl14)

[Back to BioLiP]