Structure of PDB 8hkz Chain L141

Receptor sequence
>8hkzL141 (length=86) Species: 330779 (Sulfolobus acidocaldarius DSM 639) [Search protein sequence]
AIEIGRICVKTRGREAGKKCVIVDIIDSNFVLVTGPKEINGVKRRRVNIL
HIEPTDKKVEINKGATDQEVKQAIEQSGLTDFIKEA
3D structure
PDB8hkz Cryo-electron microscopy structure and translocation mechanism of the crenarchaeal ribosome.
ChainL141
Resolution4.78 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna L141 R14 G15 R16 F32 K45 R47 R48 V49 N50 L52 H53 R12 G13 R14 F30 K43 R45 R46 V47 N48 L50 H51
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
GO:0042273 ribosomal large subunit biogenesis
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8hkz, PDBe:8hkz, PDBj:8hkz
PDBsum8hkz
PubMed37604686
UniProtQ4JAJ9|RL14E_SULAC Large ribosomal subunit protein eL14 (Gene Name=rpl14e)

[Back to BioLiP]