Structure of PDB 8hkv Chain L13P

Receptor sequence

>8hkvL13P (length=140) Species: 330779 (Sulfolobus acidocaldarius DSM 639)

VIVDATNQILGRMSTHIAKLLKSGKKVYVVNAEKAIISGPRSRVLEGYSL
LFTVKTMQNPYRQGIRRPRNPINIVKRTVRGMLPKNKLGKQIYRNLKAYI
GIPKELEGKSMIRFDDADVSRLKGKYITVAELSRLLGGLK

3D structure

• PDB: 8hkv Cryo-EM Structures and Translocation Mechanism of Crenarchaeota Ribosome
• Chain: L13P
• Resolution: 4.94 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	L13P	G18 R19 T22 K26 K29 S45 R50 L57 T60 V61 K62 T63 M64 Q65 N66 P67 Y68 R69 Q70 I72 R73 R74 R76 N77 N80 K83 R84 T85 R87 G88 M89 L90 P91 K92 N93 K94 L95 R101 K104 A105 D123 R128 L129 K130 K132 R141 L142	G11 R12 T15 K19 K22 S38 R43 L50 T53 V54 K55 T56 M57 Q58 N59 P60 Y61 R62 Q63 I65 R66 R67 R69 N70 N73 K76 R77 T78 R80 G81 M82 L83 P84 K85 N86 K87 L88 R94 K97 A98 D116 R121 L122 K123 K125 R134 L135

Gene Ontology

Molecular Function

• GO:0003729 mRNA binding
• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation
• GO:0017148 negative regulation of translation

Cellular Component

• GO:0005840 ribosome
• GO:0015934 large ribosomal subunit
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:8hkv, PDBe:8hkv, PDBj:8hkv
• PDBsum: 8hkv
• PubMed: 37604686
• UniProt: P39473|RL13_SULAC Large ribosomal subunit protein uL13 (Gene Name=rpl13)