Structure of PDB 8hku Chain L13P

Receptor sequence

>8hkuL13P (length=140) Species: 330779 (Sulfolobus acidocaldarius DSM 639) [Search protein sequence]

VIVDATNQILGRMSTHIAKLLKSGKKVYVVNAEKAIISGPRSRVLEGYSL
LFTVKTMQNPYRQGIRRPRNPINIVKRTVRGMLPKNKLGKQIYRNLKAYI
GIPKELEGKSMIRFDDADVSRLKGKYITVAELSRLLGGLK

3D structure

PDB

8hku Cryo-EM Structures and Translocation Mechanism of Crenarchaeota Ribosome

Chain

L13P

Resolution

2.72 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	L13P	G18 R19 T22 S45 R50 L57 L58 F59 T60 V61 K62 T63 M64 Q65 N66 P67 Y68 R69 Q70 I72 R73 R74 R76 N80 K83 R84 T85 R87 G88 M89 P91 N93 K94 L95 R101 K104 A105 Y106 D123 L129 K130	G11 R12 T15 S38 R43 L50 L51 F52 T53 V54 K55 T56 M57 Q58 N59 P60 Y61 R62 Q63 I65 R66 R67 R69 N73 K76 R77 T78 R80 G81 M82 P84 N86 K87 L88 R94 K97 A98 Y99 D116 L122 K123

Gene Ontology

	Molecular Function
GO:0003729	mRNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation
GO:0017148	negative regulation of translation

	Cellular Component
GO:0005840	ribosome
GO:0015934	large ribosomal subunit
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:8hku, PDBe:8hku, PDBj:8hku
PDBsum	8hku
PubMed	37604686
UniProt	P39473\|RL13_SULAC Large ribosomal subunit protein uL13 (Gene Name=rpl13)