Structure of PDB 8hl2 Chain L10E

Receptor sequence

>8hl2L10E (length=164) Species: 330779 (Sulfolobus acidocaldarius DSM 639) [Search protein sequence]

RPGRCYRKFSGPAYTRREYIPGIPMPKITKFVMGNVNGDYDYELRLITTE
KGQIRHNALEAARVIALKYLSKKLASEQNFALVVTKYPHHVIRENKMMAF
AGADRLQDGMRLSFGKPIGTAARLEKLGELVMYVRVKKEHLEAAKEALKI
ASSKLPIRTKIEIS

3D structure

PDB

8hl2 Cryo-EM Structures and Translocation Mechanism of Crenarchaeota Ribosome

Chain

L10E

Resolution

4.1 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	rna	L10E	R4 R7 C8 S13 G14 P15 A16 T18 R19 Y22 F34 A61 K71 T88 K89 Y90 H92 R96 E97 N98 K99 R108 G112 M113 R114 L115 S116 F117 K148 K157 K163	R1 R4 C5 S10 G11 P12 A13 T15 R16 Y19 F31 A58 K68 T85 K86 Y87 H89 R93 E94 N95 K96 R105 G109 M110 R111 L112 S113 F114 K145 K154 K160
BS02	rna	L10E	K11 K129	K8 K126
BS03	rna	L10E	F103 D107 L109	F100 D104 L106

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0000027	ribosomal large subunit assembly
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8hl2, PDBe:8hl2, PDBj:8hl2
PDBsum	8hl2
PubMed	37604686
UniProt	Q4JC84\|RL10E_SULAC Large ribosomal subunit protein uL16 (Gene Name=rpl10e)

[Back to BioLiP]