Structure of PDB 8hkz Chain L10E

Receptor sequence

>8hkzL10E (length=164) Species: 330779 (Sulfolobus acidocaldarius DSM 639) [Search protein sequence]

RPGRCYRKFSGPAYTRREYIPGIPMPKITKFVMGNVNGDYDYELRLITTE
KGQIRHNALEAARVIALKYLSKKLASEQNFALVVTKYPHHVIRENKMMAF
AGADRLQDGMRLSFGKPIGTAARLEKLGELVMYVRVKKEHLEAAKEALKI
ASSKLPIRTKIEIS

3D structure

PDB

8hkz Cryo-electron microscopy structure and translocation mechanism of the crenarchaeal ribosome.

Chain

L10E

Resolution

4.78 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	L10E	R4 P5 R7 R10 K11 S13 G14 P15 Y17 R19 R20 E21 Y22 F34 V35 R58 N60 A61 K71 K75 K89 Y90 H92 R96 E97 N98 M101 G105 R108 Q110 M113 R114 L115 F117 G118 S156 K157 L158 P159 R161 K163	R1 P2 R4 R7 K8 S10 G11 P12 Y14 R16 R17 E18 Y19 F31 V32 R55 N57 A58 K68 K72 K86 Y87 H89 R93 E94 N95 M98 G102 R105 Q107 M110 R111 L112 F114 G115 S153 K154 L155 P156 R158 K160
BS02	rna	L10E	E53 K129	E50 K126

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0000027	ribosomal large subunit assembly
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8hkz, PDBe:8hkz, PDBj:8hkz
PDBsum	8hkz
PubMed	37604686
UniProt	Q4JC84\|RL10E_SULAC Large ribosomal subunit protein uL16 (Gene Name=rpl10e)

[Back to BioLiP]