Structure of PDB 8vs9 Chain L1

Receptor sequence
>8vs9L1 (length=134) Species: 562 (Escherichia coli) [Search protein sequence]
KLTKRMRVIREKVDATKQYDINEAIALLKELATAKFVESVDVAVNLGIDA
RKSDQNVRGATVLPHGTGQVRYRNDKNGIIHTTIGKVDFDADKLKENLEA
LLVALKKAKPTQAKGVYIKKVSISTTMGAGVAVD
3D structure
PDB8vs9 Endogenous trans-translation structure visualizes the decoding of the first tmRNA alanine codon.
ChainL1
Resolution3.9 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna L1 K3 T5 K6 R7 M8 T18 A36 K37 F38 S41 D43 N47 R164 I170 H172 K205 S213 S215 T217 M218 G219 A220 G221 K1 T3 K4 R5 M6 T16 A34 K35 F36 S39 D41 N45 R73 I79 H81 K114 S122 S124 T126 M127 G128 A129 G130
BS02 rna L1 R53 S55 K167 R51 S53 K76
Gene Ontology
Molecular Function
GO:0000049 tRNA binding
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
GO:0006417 regulation of translation
Cellular Component
GO:0005840 ribosome
GO:0015934 large ribosomal subunit
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8vs9, PDBe:8vs9, PDBj:8vs9
PDBsum8vs9
PubMed38500588
UniProtB7MIX0|RL1_ECO45 Large ribosomal subunit protein uL1 (Gene Name=rplA)

[Back to BioLiP]