Structure of PDB 6xiq Chain L1

Receptor sequence
>6xiqL1 (length=204) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]
VKELLKYSNETKKRNFLETVELQVGLKNYDPQRDKRFSGSLKLPNCPRPN
MSICIFGDAFDVDRAKSCGVDAMSVDDLKKLNKNKKLIKKLSKKYNAFIA
SEVLIKQVPRLLGPQLSKAGKFPTPVSHNDDLYGKVTDVRSTIKFQLKKV
LCLAVAVGNVEMEEDVLVNQILMSVNFFVSLLKKNWQNVGSLVVKSSMGP
AFRL
3D structure
PDB6xiq Structural impact of K63 ubiquitin on yeast translocating ribosomes under oxidative stress.
ChainL1
Resolution4.2 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna L1 N27 L34 Q35 G37 I65 K98 L99 I100 K101 K102 Q119 P121 R122 P126 L128 T154 K156 K160 C164 M210 P212 N15 L22 Q23 G25 I53 K86 L87 I88 K89 K90 Q107 P109 R110 P114 L116 T142 K144 K148 C152 M198 P200
BS02 rna L1 L116 L123 L124 L104 L111 L112
Gene Ontology
--> -->
 
 
UnboundLocalError		Python 3.6.8: /usr/bin/python3
Mon Nov 25 04:46:20 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)
   1444         else:
=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)
   1446     
   1447     uniprot_line=''
pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '6xiq', asym_id = 'L1', title = 'Structural impact of K63 ubiquitin on yeast translocating ribosomes under oxidative stress.'
 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='6xiq', asym_id='L1', title='Structural impact of K63 ubiquitin on yeast translocating ribosomes under oxidative stress.')
    839 
    840     if go:
=>  841         display_go(go,uniprot,pdbid,asym_id)
    842     return pubmed,uniprot
    843 
global display_go = <function display_go>, go = '0003723,0003735,0006412,0015934', uniprot = '', pdbid = '6xiq', asym_id = 'L1'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003723,0003735,0006412,0015934', uniprot='', pdbid='6xiq', asym_id='L1')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>