Structure of PDB 5zf0 Chain L1

Receptor sequence

>5zf0L1 (length=151) Species: 197221 (Thermosynechococcus vestitus BP-1) [Search protein sequence]

LVKPYNGDPFVGHLSTPISDSGLVKTFIGNLPAYRQGLSPILRGLEVGMA
HGYFLIGPWVKLGPLRDSDVANLGGLISGIALILVATACLAAYGLVSFQK
GGSSSDPLKTSEGWSQFTAGFFVGAMGSAFVAFFLLENFLVVDGIMTGLF
N

3D structure

PDB

5zf0 X-ray structure of an asymmetrical trimeric ferredoxin-photosystem I complex

Chain

Resolution

4.2 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	CLA	L1	L85 A89	L82 A86
BS02	CLA	L1	W62 S81	W59 S78
BS03	CLA	L1	H16 T19 I21	H13 T16 I18
BS04	CLA	L1	P61 W62 L65 G66 P67 R69	P58 W59 L62 G63 P64 R66
BS05	CA	L1	P67 D70	P64 D67
BS06	CLA	L1	R38 E49 M52	R35 E46 M49
BS07	CLA	L1	P35 A36 H54	P32 A33 H51
BS08	CLA	L1	Y56 F57 G60 P61 L138 L139 F142	Y53 F54 G57 P58 L135 L136 F139
BS09	CLA	L1	T90 A91 A94	T87 A88 A91
BS10	CLA	L1	Y56 I148	Y53 I145

Gene Ontology

	Biological Process
GO:0015979	photosynthesis

	Cellular Component
GO:0009522	photosystem I
GO:0009538	photosystem I reaction center
GO:0009579	thylakoid
GO:0016020	membrane
GO:0031676	plasma membrane-derived thylakoid membrane
GO:0042651	thylakoid membrane

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:5zf0, PDBe:5zf0, PDBj:5zf0
PDBsum	5zf0
PubMed	29610537
UniProt	Q8DGB4\|PSAL_THEVB Photosystem I reaction center subunit XI (Gene Name=psaL)

[Back to BioLiP]