Structure of PDB 9at8 Chain L |
>9at8L (length=121) Species: 9606 (Homo sapiens) [Search protein sequence] |
DVQLQESGPGLVKPSQSLSLTCTVSGYSITSDYAWNWIRQFPGNKLEWMG YISYTLTTGYNPSLKSRISITRDSSKNQFFLQLNSVTTEDTATYYCARSG WLLPYWYFDVWGAGTTVTVSS |
|
PDB | 9at8 A neutralizing antibody prevents postfusion transition of measles virus fusion protein. |
Chain | L |
Resolution | 3.6 Å |
3D structure |
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
peptide |
L |
Y54 T55 T57 |
Y54 T55 T57 |
|
|
|