Structure of PDB 8y6o Chain L

Receptor sequence

>8y6oL (length=318) Species: 9606 (Homo sapiens) [Search protein sequence]

WDSKMFAEIMMKIEEYISKQAPEYRVIVDANNLTVEIENELNIIHKFIRD
KYSKRFPELESLVPNALDYIRTVKELGNSLDKCKNNENLQQILTNATIMV
VSVTASTTQGQQLSEEELERLEEACDMALELNASKHRIYEYVESRMSFIA
PNLSIIIGASTAAKIMGVAGGLTNLSKMPACNIMLLGAQRKTLSVLPHTG
YIYHSDIVQSLPPDLRRKAARLVAAKCTLAARVDSFHESTEGKVGYELKD
EIERKFDKWQEPPPVKQVKPLPAPLDGQRKKRGGRRYRKMKERLGLTEIR
KQANRMSFGEIEEDAYQE

3D structure

PDB

8y6o Structural basis of U12-type intron engagement by the fully assembled human minor spliceosome

Chain

Resolution

3.38 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	L	M244 C247 N248 M250 L251 L252 R256 H270 R289 K290 R293 A297 K298 K327 K330 K338 R351 K353 R354 R358 K361 R365	M178 C181 N182 M184 L185 L186 R190 H198 R217 K218 R221 A225 K226 K255 K258 K266 R279 K281 R282 R286 K289 R293
BS02	rna	L	K352 G355 G356 R357	K280 G283 G284 R285

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0005515	protein binding
GO:0030621	U4 snRNA binding
GO:0030622	U4atac snRNA binding
GO:0030674	protein-macromolecule adaptor activity
GO:0042802	identical protein binding
GO:0043021	ribonucleoprotein complex binding
GO:0070990	snRNP binding

	Biological Process
GO:0000244	spliceosomal tri-snRNP complex assembly
GO:0000398	mRNA splicing, via spliceosome
GO:0006397	mRNA processing
GO:0008380	RNA splicing
GO:0048254	snoRNA localization
GO:0071166	ribonucleoprotein complex localization

	Cellular Component
GO:0005634	nucleus
GO:0005654	nucleoplasm
GO:0005681	spliceosomal complex
GO:0005684	U2-type spliceosomal complex
GO:0005687	U4 snRNP
GO:0005690	U4atac snRNP
GO:0015030	Cajal body
GO:0016607	nuclear speck
GO:0046540	U4/U6 x U5 tri-snRNP complex
GO:0071005	U2-type precatalytic spliceosome
GO:0071011	precatalytic spliceosome
GO:0071339	MLL1 complex
GO:0097526	spliceosomal tri-snRNP complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8y6o, PDBe:8y6o, PDBj:8y6o
PDBsum	8y6o
PubMed	38484052
UniProt	Q8WWY3\|PRP31_HUMAN U4/U6 small nuclear ribonucleoprotein Prp31 (Gene Name=PRPF31)

[Back to BioLiP]