Structure of PDB 8y36 Chain L

Receptor sequence

>8y36L (length=120) Species: 1280 (Staphylococcus aureus) [Search protein sequence]

YRKLGRTSDQRKAMLRDLATSLIISERIETTEARAKEVRSVVEKLITLGK
KGDLASRRNAAKTLRNVEILNEDETTQTALQKLFGEIAERYTERQGGYTR
ILKQGPRRGDGAESVIIELV

3D structure

PDB

8y36 Synthetic macrolides overcoming MLS B K-resistant pathogens.

Chain

Resolution

2.65 Å

3D
structure

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	L	Y3 R4 K5 G7 Q12 R13 K14 L17 R18 L20 S23 I30 E31 T32 R36 K38 E39 R41 S42 E45 K46 T49 L56 R59 R60 K64 R67 N68 R96 Q97 G98 G99 T101 R102 K105 R109 R110 G111 D112 G113 A114	Y1 R2 K3 G5 Q10 R11 K12 L15 R16 L18 S21 I28 E29 T30 R34 K36 E37 R39 S40 E43 K44 T47 L54 R57 R58 K62 R65 N66 R94 Q95 G96 G97 T99 R100 K103 R107 R108 G109 D110 G111 A112

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:8y36, PDBe:8y36, PDBj:8y36
PDBsum	8y36
PubMed	38992047
UniProt	Q7A087\|RL17_STAAW Large ribosomal subunit protein bL17 (Gene Name=rplQ)