Structure of PDB 8x1c Chain L

Receptor sequence
>8x1cL (length=105) Species: 9606 (Homo sapiens) [Search protein sequence]
RVLDRAARQRRINRQLEALENDNFQDDPHAGLPNFQALLEEQNLSVAEGP
NYLTACAGPPSRPQRPFCAVCGFPSPYTCVSCGARYCTVRCLGTHQETRC
LKWTV
3D structure
PDB8x1c Structure of nucleosome-bound SRCAP-C in the ADP-bound state
ChainL
Resolution3.2 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna L R17 R26 R1 R10
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0031491 nucleosome binding
GO:0042393 histone binding
GO:0046872 metal ion binding
Biological Process
GO:0003015 heart process
GO:0006325 chromatin organization
GO:0006338 chromatin remodeling
GO:0006355 regulation of DNA-templated transcription
GO:0036335 intestinal stem cell homeostasis
GO:0042692 muscle cell differentiation
GO:0055074 calcium ion homeostasis
GO:0060261 positive regulation of transcription initiation by RNA polymerase II
GO:1902164 positive regulation of DNA damage response, signal transduction by p53 class mediator resulting in transcription of p21 class mediator
GO:1905458 positive regulation of lymphoid progenitor cell differentiation
Cellular Component
GO:0000786 nucleosome
GO:0000812 Swr1 complex
GO:0005634 nucleus
GO:0005654 nucleoplasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8x1c, PDBe:8x1c, PDBj:8x1c
PDBsum8x1c
PubMed38331872
UniProtO43257|ZNHI1_HUMAN Zinc finger HIT domain-containing protein 1 (Gene Name=ZNHIT1)

[Back to BioLiP]