Structure of PDB 8wmw Chain L

Receptor sequence

>8wmwL (length=151) Species: 52970 (Rhodomonas salina) [Search protein sequence]

SQFIKPYNDDPFVGNLATPVSTSSFTKSLLSNLPAYRAGLSPLLRGVEIG
LTHGYFLVGPFYKLGPLRNSDVALLSGFFSALGLIVILVACLTIYGVVSF
EETEAKDQLQTAKGWRQFTSGWLVGSVGGASFAYILISNIPFLQTAGMSM
L

3D structure

PDB

8wmw Growth phase-dependent reorganization of cryptophyte photosystem I antennae.

Chain

Resolution

3.3 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	CLA	L	F62 L65 P67	F61 L64 P66
BS02	CLA	L	T19 V21 L30	T18 V20 L29
BS03	CLA	L	C92 I95	C91 I94
BS04	CLA	L	P67 F80 S81 I88	P66 F79 S80 I87
BS05	WVN	L	L89 C92 W123	L88 C91 W122
BS06	CLA	L	R38 E49 T53	R37 E48 T52
BS07	CLA	L	L34 P35 I50 T53 H54 F57	L33 P34 I49 T52 H53 F56
BS08	CLA	L	Y56 F57 G60 P61 K64 I138 F143 L144 A147	Y55 F56 G59 P60 K63 I137 F142 L143 A146
BS09	WVN	L	L52 Y56 G129 F133	L51 Y55 G128 F132
BS10	CLA	L	A147 G148 M149 L152	A146 G147 M148 L151
BS11	CLA	L	F79 Y135	F78 Y134
BS12	II0	L	L76 F80	L75 F79
BS13	CLA	L	F133 L137 N140	F132 L136 N139

Gene Ontology

	Biological Process
GO:0015979	photosynthesis

	Cellular Component
GO:0009507	chloroplast
GO:0009522	photosystem I
GO:0009535	chloroplast thylakoid membrane
GO:0009579	thylakoid
GO:0016020	membrane

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8wmw, PDBe:8wmw, PDBj:8wmw
PDBsum	8wmw
PubMed	38734819
UniProt	A6MVV8

[Back to BioLiP]