Structure of PDB 8wmv Chain L

Receptor sequence

>8wmvL (length=151) Species: 52970 (Rhodomonas salina) [Search protein sequence]

SQFIKPYNDDPFVGNLATPVSTSSFTKSLLSNLPAYRAGLSPLLRGVEIG
LTHGYFLVGPFYKLGPLRNSDVALLSGFFSALGLIVILVACLTIYGVVSF
EETEAKDQLQTAKGWRQFTSGWLVGSVGGASFAYILISNIPFLQTAGMSM
L

3D structure

PDB

8wmv Growth phase-dependent reorganization of cryptophyte photosystem I antennae.

Chain

Resolution

2.94 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	CLA	L	I5 P20	I4 P19
BS02	CLA	L	P61 L65 P67	P60 L64 P66
BS03	CLA	L	T19 V21	T18 V20
BS04	CLA	L	I88 Y96	I87 Y95
BS05	CLA	L	P67 F80 S81	P66 F79 S80
BS06	WVN	L	L89 C92 W123	L88 C91 W122
BS07	CLA	L	N33 R38 E49 T53	N32 R37 E48 T52
BS08	CLA	L	P35 T53 H54 F57	P34 T52 H53 F56
BS09	CLA	L	Y56 F57 G60 P61 K64 L137 I138 A147	Y55 F56 G59 P60 K63 L136 I137 A146
BS10	WVN	L	L52 Y56 G129 F133	L51 Y55 G128 F132
BS11	CLA	L	A147 L152	A146 L151
BS12	CLA	L	F79 Y135	F78 Y134
BS13	CLA	L	L137 N140	L136 N139

Gene Ontology

	Biological Process
GO:0015979	photosynthesis

	Cellular Component
GO:0009507	chloroplast
GO:0009522	photosystem I
GO:0009535	chloroplast thylakoid membrane
GO:0009579	thylakoid
GO:0016020	membrane

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8wmv, PDBe:8wmv, PDBj:8wmv
PDBsum	8wmv
PubMed	38734819
UniProt	A6MVV8

[Back to BioLiP]