Structure of PDB 8wmj Chain L

Receptor sequence

>8wmjL (length=151) Species: 52970 (Rhodomonas salina)

SQFIKPYNDDPFVGNLATPVSTSSFTKSLLSNLPAYRAGLSPLLRGVEIG
LTHGYFLVGPFYKLGPLRNSDVALLSGFFSALGLIVILVACLTIYGVVSF
EETEAKDQLQTAKGWRQFTSGWLVGSVGGASFAYILISNIPFLQTAGMSM
L

3D structure

• PDB: 8wmj Growth phase-dependent reorganization of cryptophyte photosystem I antennae.
• Chain: L
• Resolution: 3.0 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	CLA	L	I5 T19 P20 V21	I4 T18 P19 V20
BS02	CLA	L	P61 F62 L65 P67	P60 F61 L64 P66
BS03	CLA	L	T19 V21 S22 L30	T18 V20 S21 L29
BS04	CLA	L	I88 Y96	I87 Y95
BS05	CLA	L	P67 F80 S81	P66 F79 S80
BS06	WVN	L	C92 L93 Y96 F119 W123	C91 L92 Y95 F118 W122
BS07	CLA	L	N33 R38 E49 T53	N32 R37 E48 T52
BS08	CLA	L	V21 L34 P35 A36 I50 T53 H54 F57	V20 L33 P34 A35 I49 T52 H53 F56
BS09	CLA	L	Y56 F57 G60 P61 K64 I138 L144	Y55 F56 G59 P60 K63 I137 L143
BS10	WVN	L	Y56 F133	Y55 F132
BS11	CLA	L	F79 Y135	F78 Y134

Gene Ontology

Biological Process

• GO:0015979 photosynthesis

Cellular Component

• GO:0009507 chloroplast
• GO:0009522 photosystem I
• GO:0009535 chloroplast thylakoid membrane
• GO:0009579 thylakoid
• GO:0016020 membrane

External links

• PDB: RCSB:8wmj, PDBe:8wmj, PDBj:8wmj
• PDBsum: 8wmj
• PubMed: 38734819
• UniProt: A6MVV8