Structure of PDB 8wm6 Chain L

Receptor sequence

>8wm6L (length=151) Species: 52970 (Rhodomonas salina) [Search protein sequence]

SQFIKPYNDDPFVGNLATPVSTSSFTKSLLSNLPAYRAGLSPLLRGVEIG
LTHGYFLVGPFYKLGPLRNSDVALLSGFFSALGLIVILVACLTIYGVVSF
EETEAKDQLQTAKGWRQFTSGWLVGSVGGASFAYILISNIPFLQTAGMSM
L

3D structure

PDB

8wm6 Growth phase-dependent reorganization of cryptophyte photosystem I antennae.

Chain

Resolution

2.7 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	CLA	L	I5 P20	I4 P19
BS02	CLA	L	P61 F62 L65 P67	P60 F61 L64 P66
BS03	CLA	L	T19 V21 L30	T18 V20 L29
BS04	CLA	L	F57 L89	F56 L88
BS05	CLA	L	I88 Y96	I87 Y95
BS06	CLA	L	C92 I95	C91 I94
BS07	CLA	L	P67 S81 I88	P66 S80 I87
BS08	WVN	L	C92 W123	C91 W122
BS09	CLA	L	N33 R38 E49 T53	N32 R37 E48 T52
BS10	CLA	L	P35 A36 I50 T53 H54 F57	P34 A35 I49 T52 H53 F56
BS11	CLA	L	Y56 F57 G60 P61 K64 F143 L144	Y55 F56 G59 P60 K63 F142 L143
BS12	WVN	L	L52 Y56 G129 F133	L51 Y55 G128 F132
BS13	CLA	L	A147 G148 M149 L152	A146 G147 M148 L151
BS14	CLA	L	F79 Y135	F78 Y134
BS15	CLA	L	F133 N140	F132 N139

Gene Ontology

	Biological Process
GO:0015979	photosynthesis

	Cellular Component
GO:0009507	chloroplast
GO:0009522	photosystem I
GO:0009535	chloroplast thylakoid membrane
GO:0009579	thylakoid
GO:0016020	membrane

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8wm6, PDBe:8wm6, PDBj:8wm6
PDBsum	8wm6
PubMed	38734819
UniProt	A6MVV8

[Back to BioLiP]