Structure of PDB 8wey Chain L

Receptor sequence
>8weyL (length=121) Species: 2771 (Cyanidium caldarium) [Search protein sequence]
PINSSSLTRGYLAQLPIYRSGLSPFLRGLEIGMAHGYFLIGPFVELGPLR
NTEMKYLAGLLSAVGLVVILTLGMLLYGYVSFTNDSQDVESLEGWRQLAS
GFLLGAVGGAGFAYLLIYSFI
3D structure
PDB8wey Structure of PSI-LHCI from Cyanidium caldarium provides evolutionary insights into conservation and diversity of red-lineage LHCs
ChainL
Resolution1.92 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 CLA L P61 L65 P67 P42 L46 P48
BS02 CLA L P67 L80 S81 P48 L61 S62
BS03 CLA L L89 Y96 L70 Y77
BS04 CLA L Y30 Q33 R38 E49 Y11 Q14 R19 E30
BS05 CLA L P35 I36 I50 H54 F57 P16 I17 I31 H35 F38
BS06 CLA L Y56 F57 G60 P61 E64 Y37 F38 G41 P42 E45
Gene Ontology
--> -->
 
 
UnboundLocalError
Python 3.6.8: /usr/bin/python3
Tue Nov 26 07:34:58 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)
   1444         else:
=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)
   1446     
   1447     uniprot_line=''
pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '8wey', asym_id = 'L', title = 'Structure of PSI-LHCI from Cyanidium caldarium p...to conservation and diversity of red-lineage LHCs'
 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='8wey', asym_id='L', title='Structure of PSI-LHCI from Cyanidium caldarium p...to conservation and diversity of red-lineage LHCs')
    839 
    840     if go:
=>  841         display_go(go,uniprot,pdbid,asym_id)
    842     return pubmed,uniprot
    843 
global display_go = <function display_go>, go = '0009522,0009538,0015979', uniprot = '', pdbid = '8wey', asym_id = 'L'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0009522,0009538,0015979', uniprot='', pdbid='8wey', asym_id='L')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>