Structure of PDB 8w2r Chain L |
>8w2rL (length=64) Species: 11676 (Human immunodeficiency virus 1) [Search protein sequence] |
ELQKQITKIQNFRVYYRDSRDPVWKGPAKLLWKGEGAVVIQDNSDIKVVP RRKAKIIRDYGKQM |
|
PDB | 8w2r HIV-1 integrase assembles multiple species of stable synaptic complex intasomes that are active for concerted DNA integration in vitro. |
Chain | L |
Resolution | 3.23 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
dna |
L |
R228 R263 |
R17 R52 |
|
|
|
|