Structure of PDB 8vtn Chain L

Receptor sequence

>8vtnL (length=281) Species: 1063 (Cereibacter sphaeroides)

ALLSFERKYRVPGGTLVGGNLFDFWVGPFYVGFFGVATFFFAALGIILIA
WSAVLQGTWNPQLISVYPPALEYGLGGAPLAKGGLWQIITICATGAFVSW
ALREVEICRKLGIGYHIPFAFAFAILAYLTLVLFRPVMMGAWGYAFPYGI
WTHLDWVSNTGYTYGNFHYNPAHMIAISFFFTNALALALHGALVLSAANP
EKGKEMRTPDHEDTFFRDLVGYSIGTLGIHRLGLLLSLSAVFFSALCMII
TGTIWFDQWVDWWQWWVKLPWWANIPGGING

3D structure

• PDB: 8vtn Crystal structure of R. sphaeroides Photosynthetic Reaction Center variant Y(M210)2-nitrophenylalanine
• Chain: L
• Resolution: 3.57 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	BCL	L	Y128 H153 L154	Y128 H153 L154
BS02	BCL	L	F97 A124 I125 A127 Y128 V157 F167 H168 H173 I177 F180 S244 A245 M248	F97 A124 I125 A127 Y128 V157 F167 H168 H173 I177 F180 S244 A245 M248
BS03	FE	L	H190 H230	H190 H230
BS04	BPH	L	F181 L185 L189	F181 L185 L189
BS05	BPH	L	A93 A96 W100 E104 A120 F121 Y148 V241	A93 A96 W100 E104 A120 F121 Y148 V241
BS06	BCL	L	H168 M174 I177 S178	H168 M174 I177 S178

Gene Ontology

Molecular Function

• GO:0042314 bacteriochlorophyll binding
• GO:0045156 electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity
• GO:0046872 metal ion binding

Biological Process

• GO:0009772 photosynthetic electron transport in photosystem II
• GO:0015979 photosynthesis
• GO:0019684 photosynthesis, light reaction

Cellular Component

• GO:0016020 membrane
• GO:0030077 plasma membrane light-harvesting complex
• GO:0042717 plasma membrane-derived chromatophore membrane

External links

• PDB: RCSB:8vtn, PDBe:8vtn, PDBj:8vtn
• PDBsum: 8vtn
• UniProt: P0C0Y8|RCEL_CERSP Reaction center protein L chain (Gene Name=pufL)