Structure of PDB 8vtl Chain L

Receptor sequence

>8vtlL (length=281) Species: 1063 (Cereibacter sphaeroides)

ALLSFERKYRVPGGTLVGGNLFDFWVGPFYVGFFGVATFFFAALGIILIA
WSAVLQGTWNPQLISVYPPALEYGLGGAPLAKGGLWQIITICATGAFVSW
ALREVEICRKLGIGYHIPFAFAFAILAYLTLVLFRPVMMGAWGYAFPYGI
WTHLDWVSNTGYTYGNFHYNPAHMIAISFFFTNALALALHGALVLSAANP
EKGKEMRTPDHEDTFFRDLVGYSIGTLGIHRLGLLLSLSAVFFSALCMII
TGTIWFDQWVDWWQWWVKLPWWANIPGGING

3D structure

• PDB: 8vtl Crystal structure of R. sphaeroides Photosynthetic Reaction Center variant Y(M210)2-methoxyphenylalanine
• Chain: L
• Resolution: 3.05 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	BPH	L	F181 L185 L189	F181 L185 L189
BS02	BCL	L	I46 H153 L154	I46 H153 L154
BS03	BCL	L	F97 A124 A127 V157 F167 H168 H173 I177 F180 S244 M248	F97 A124 A127 V157 F167 H168 H173 I177 F180 S244 M248
BS04	FE	L	H190 H230	H190 H230
BS05	BPH	L	A93 W100 E104 A120 F121 Y148 H153 V241	A93 W100 E104 A120 F121 Y148 H153 V241
BS06	BCL	L	H168 M174 I177 S178	H168 M174 I177 S178

Gene Ontology

Molecular Function

• GO:0042314 bacteriochlorophyll binding
• GO:0045156 electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity
• GO:0046872 metal ion binding

Biological Process

• GO:0009772 photosynthetic electron transport in photosystem II
• GO:0015979 photosynthesis
• GO:0019684 photosynthesis, light reaction

Cellular Component

• GO:0016020 membrane
• GO:0030077 plasma membrane light-harvesting complex
• GO:0042717 plasma membrane-derived chromatophore membrane

External links

• PDB: RCSB:8vtl, PDBe:8vtl, PDBj:8vtl
• PDBsum: 8vtl
• UniProt: P0C0Y8|RCEL_CERSP Reaction center protein L chain (Gene Name=pufL)