Structure of PDB 8v9l Chain L

Receptor sequence

>8v9lL (length=146) Species: 246196 (Mycolicibacterium smegmatis MC2 155) [Search protein sequence]

PTYTPKAGDTTRSWYVIDASDVVLGRLASAAATLLRGKHKPTFTPNVDGG
DFVIVINADKIAVSGDKLTKKFAYRHSGYPGGLRKRTIGELLEKHPTRVV
ENAIIGMLPHNKLGRQIQKKLKVYAGPDHPHAAQQPIPFEIKQVAQ

3D structure

PDB

8v9l A new family of bacterial ribosome hibernation factors

Chain

Resolution

3.0 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	L	P2 T3 P6 D22 G26 R27 S30 R37 K39 N47 S65 K68 K72 Y75 R76 H77 S78 Y80 G82 L84 R85 R87 R99 E102 A104 G107 M108 N112 K113 L114 R116 K120 H132 A134 Q135 Q144 Q147	P1 T2 P5 D21 G25 R26 S29 R36 K38 N46 S64 K67 K71 Y74 R75 H76 S77 Y79 G81 L83 R84 R86 R98 E101 A103 G106 M107 N111 K112 L113 R115 K119 H131 A133 Q134 Q143 Q146

Gene Ontology

	Molecular Function
GO:0003729	mRNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation
GO:0017148	negative regulation of translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:8v9l, PDBe:8v9l, PDBj:8v9l
PDBsum	8v9l
PubMed	38355796
UniProt	A0QSP8\|RL13_MYCS2 Large ribosomal subunit protein uL13 (Gene Name=rplM)