Structure of PDB 8v87 Chain L

Receptor sequence

>8v87L (length=121) Species: 1247190 (Saccharomyces cerevisiae BY4741) [Search protein sequence]

ILKNHFRKHWQERVKVHFDQAGKKVSRRNARATRAAKIAPRPLDLLRPVV
RAPTVKYNRKVRAGRGFTLAEVKAAGLTAAYARTIGIAVDHRRQNRNQEI
FDANVQRLKEYQSKIIVFPRN

3D structure

PDB

8v87 The DEAD-box ATPase Dbp10/DDX54 initiates peptidyl transferase center formation during 60S ribosome biogenesis.

Chain

Resolution

2.66 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	L	L10 K11 N12 H13 F14 R15 K16 W18 Q28 K31 K32 R35 R36 R39 R42 R55 V58 R59 A60 P61 T62 V63 Y65 N66 K68 R70 G72 R73 R91 D98 H99 R100 R101 R104 N105 R128	L2 K3 N4 H5 F6 R7 K8 W10 Q20 K23 K24 R27 R28 R31 R34 R47 V50 R51 A52 P53 T54 V55 Y57 N58 K60 R62 G64 R65 R83 D90 H91 R92 R93 R96 N97 R120
BS02	rna	L	F26 D27 S34	F18 D19 S26

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:8v87, PDBe:8v87, PDBj:8v87
PDBsum	8v87
PubMed	38632236
UniProt	Q12690\|RL13A_YEAST Large ribosomal subunit protein eL13A (Gene Name=RPL13A)