Structure of PDB 8v84 Chain L

Receptor sequence
>8v84L (length=110) Species: 1247190 (Saccharomyces cerevisiae BY4741) [Search protein sequence]
ERVKVHFDQAGKKVSRRNARATRAAKIAPRPLDLLRPVVRAPTVKYNRKV
RAGRGFTLAEVKAAGLTAAYARTIGIAVDHRRQNRNQEIFDANVQRLKEY
QSKIIVFPRN
3D structure
PDB8v84 The DEAD-box ATPase Dbp10/DDX54 initiates peptidyl transferase center formation during 60S ribosome biogenesis.
ChainL
Resolution2.7 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna L Q28 A29 K31 K32 R35 R36 R39 R55 V58 R59 P61 T62 Y65 N66 R67 K68 R70 G72 R73 R91 D98 H99 R100 R101 R104 N105 Q9 A10 K12 K13 R16 R17 R20 R36 V39 R40 P42 T43 Y46 N47 R48 K49 R51 G53 R54 R72 D79 H80 R81 R82 R85 N86
BS02 rna L F26 D27 F7 D8
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
Biological Process
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8v84, PDBe:8v84, PDBj:8v84
PDBsum8v84
PubMed38632236
UniProtQ12690|RL13A_YEAST Large ribosomal subunit protein eL13A (Gene Name=RPL13A)

[Back to BioLiP]