Structure of PDB 8s8h Chain L

Receptor sequence

>8s8hL (length=155) Species: 284590 (Kluyveromyces lactis NRRL Y-1140) [Search protein sequence]

STELTVQSERAFQKQPHIFTNPKAKANRKTKRWYKNVGLGFKTPKTAIEG
SYIDKKCPFTGLVSIRGKILTGTVVSTRMHRTIVIRRDYLHYVPKYNRYE
KRHKNVPAHVSPAFRVQVGDIVTVGQCRPISKTVRFNVLKVASATGKANK
QFAKF

3D structure

PDB

8s8h Structural basis of AUC codon discrimination during translation initiation in yeast.

Chain

Resolution

4.0 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	L	E10 Q14 P17 H18 I19 F20 W34 K36 N37 V38 L40 K43 K56 K57 S65 I66 R67 K69 S77 R79 M80 R82 T83 R88 Y90 K96 Y97 Y100 K102 R103 H104 K105 N106 Q127 R129 P130 I131 S132 K133 T134 R136 F137 K151 F153 A154 K155 F156	E9 Q13 P16 H17 I18 F19 W33 K35 N36 V37 L39 K42 K55 K56 S64 I65 R66 K68 S76 R78 M79 R81 T82 R87 Y89 K95 Y96 Y99 K101 R102 H103 K104 N105 Q126 R128 P129 I130 S131 K132 T133 R135 F136 K150 F152 A153 K154 F155

External links

PDB	RCSB:8s8h, PDBe:8s8h, PDBj:8s8h
PDBsum	8s8h
PubMed	39193907
UniProt	Q6CX80

[Back to BioLiP]