Structure of PDB 8qp9 Chain L

Receptor sequence

>8qp9L (length=50) Species: 9606 (Homo sapiens) [Search protein sequence]

KPLPAPLDGQRKKRGGRRYRKMKERLGLTEIRKQANRMSFGEIEEDAYQE

3D structure

PDB

8qp9 Structural insights into the cross-exon to cross-intron spliceosome switch

Chain

Resolution

4.1 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	L	G355 G356	G15 G16
BS02	rna	L	K353 R354 R357 M362	K13 R14 R17 M22

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0005515	protein binding
GO:0030621	U4 snRNA binding
GO:0030622	U4atac snRNA binding
GO:0030674	protein-macromolecule adaptor activity
GO:0042802	identical protein binding
GO:0043021	ribonucleoprotein complex binding
GO:0070990	snRNP binding

	Biological Process
GO:0000244	spliceosomal tri-snRNP complex assembly
GO:0000398	mRNA splicing, via spliceosome
GO:0006397	mRNA processing
GO:0008380	RNA splicing
GO:0048254	snoRNA localization
GO:0071166	ribonucleoprotein complex localization

	Cellular Component
GO:0005634	nucleus
GO:0005654	nucleoplasm
GO:0005681	spliceosomal complex
GO:0005684	U2-type spliceosomal complex
GO:0005687	U4 snRNP
GO:0005690	U4atac snRNP
GO:0015030	Cajal body
GO:0016607	nuclear speck
GO:0046540	U4/U6 x U5 tri-snRNP complex
GO:0071005	U2-type precatalytic spliceosome
GO:0071011	precatalytic spliceosome
GO:0071339	MLL1 complex
GO:0097526	spliceosomal tri-snRNP complex

External links

PDB	RCSB:8qp9, PDBe:8qp9, PDBj:8qp9
PDBsum	8qp9
PubMed	38778104
UniProt	Q8WWY3\|PRP31_HUMAN U4/U6 small nuclear ribonucleoprotein Prp31 (Gene Name=PRPF31)