Structure of PDB 8qcq Chain L

Receptor sequence

>8qcqL (length=146) Species: 224308 (Bacillus subtilis subsp. subtilis str. 168) [Search protein sequence]

MKLHELKPSEGSRKTRNRVGRGIGSGNGKTAGKGHKGQNARSGGGVRPGF
EGGQMPLFQRLPKRGFTNINRKEYAVVNLDKLNGFAEGTEVTPELLLETG
VISKLNAGVKILGNGKLEKKLTVKANKFSASAKEAVEAAGGTAEVI

3D structure

PDB

8qcq Novel arrest peptides induce ribosome stalling by short circuiting the ribosomal peptidyltransferase activity

Chain

Resolution

2.3 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	L	L3 H4 L6 K7 S9 E10 G11 S12 R13 K14 R16 R18 V19 G20 R21 G22 G24 S25 N27 G28 K29 T30 A31 G32 K33 G34 H35 K36 G37 Q38 N39 A40 R41 S42 G43 V46 R47 F50 E51 G52 G53 Q54 M55 F58 Q59 R60 L61 P62 K63 R64 G65 F66 N68 I69 N70 R71 V76 N78 K81 S103 K104 K110 L112 G113 K127 S129 A130 S131	L3 H4 L6 K7 S9 E10 G11 S12 R13 K14 R16 R18 V19 G20 R21 G22 G24 S25 N27 G28 K29 T30 A31 G32 K33 G34 H35 K36 G37 Q38 N39 A40 R41 S42 G43 V46 R47 F50 E51 G52 G53 Q54 M55 F58 Q59 R60 L61 P62 K63 R64 G65 F66 N68 I69 N70 R71 V76 N78 K81 S103 K104 K110 L112 G113 K127 S129 A130 S131

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0015934	large ribosomal subunit
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:8qcq, PDBe:8qcq, PDBj:8qcq
PDBsum	8qcq
PubMed	38503735
UniProt	P19946\|RL15_BACSU Large ribosomal subunit protein uL15 (Gene Name=rplO)