Structure of PDB 8ovj Chain L

Receptor sequence

>8ovjL (length=144) Species: 347515 (Leishmania major strain Friedlin) [Search protein sequence]

PTRFKKCRHQRGSTFCGYGRVGKHRKHESGRGNAGGMHHHRINFDKYHPG
YFGKLGMDHYHRKKNPMWKPTINLNNLSRLIAAEEAAKAAKGGTLPVVDL
QSSGYAKLLGNGHIQVPCIVKARYVSKLADKKIRKAGGAVVLQA

3D structure

PDB

8ovj Structural and mechanistic insights into the function of Leishmania ribosome lacking a single pseudouridine modification.

Chain

Resolution

2.4 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	L	P2 T3 R4 K6 K7 R9 H10 R12 G13 T15 F16 C17 G18 Y19 G20 R21 V22 G23 H25 R26 K27 H28 E29 G31 R32 G33 N34 A35 G36 H39 H40 H41 N44 Y52 F53 K55 M58 D59 H60 Y61 H62 R63 K64 K65 T72 N74 K108 L110 G111 N112 H114 K128 L129 K132 K133 K136	P1 T2 R3 K5 K6 R8 H9 R11 G12 T14 F15 C16 G17 Y18 G19 R20 V21 G22 H24 R25 K26 H27 E28 G30 R31 G32 N33 A34 G35 H38 H39 H40 N43 Y51 F52 K54 M57 D58 H59 Y60 H61 R62 K63 K64 T71 N73 K107 L109 G110 N111 H113 K127 L128 K131 K132 K135
BS02	rna	L	R42 I43 G54 K55 G57 M58 H60	R41 I42 G53 K54 G56 M57 H59

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005730	nucleolus
GO:0005737	cytoplasm
GO:0005840	ribosome
GO:0015934	large ribosomal subunit
GO:0022625	cytosolic large ribosomal subunit
GO:0043232	intracellular non-membrane-bounded organelle
GO:1990904	ribonucleoprotein complex

External links