Structure of PDB 8kg6 Chain L

Receptor sequence
>8kg6L (length=94) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]
RKRRPQVKLTAEKLLSDKGLPYVLKNAHKRIRISSKKNSYDNLSNIIQFY
QLWAHELFPKAKFKDFMKICQTVGKTDPVLREYRVSLFRDEMGM
3D structure
PDB8kg6 Synergism between CMG helicase and leading strand DNA polymerase at replication fork.
ChainL
Resolution3.07 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna L R48 R126 R3 R81
BS02 dna L K47 K53 K2 K8
Gene Ontology
Molecular Function
GO:0003674 molecular_function
GO:0003677 DNA binding
GO:0005515 protein binding
Biological Process
GO:0000076 DNA replication checkpoint signaling
GO:0006281 DNA repair
GO:0006974 DNA damage response
GO:0007064 mitotic sister chromatid cohesion
GO:0008156 negative regulation of DNA replication
GO:0031297 replication fork processing
GO:0034087 establishment of mitotic sister chromatid cohesion
GO:0043111 replication fork arrest
GO:0043570 maintenance of DNA repeat elements
GO:0045132 meiotic chromosome segregation
GO:0051321 meiotic cell cycle
Cellular Component
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0031298 replication fork protection complex
GO:0043596 nuclear replication fork

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8kg6, PDBe:8kg6, PDBj:8kg6
PDBsum8kg6
PubMed37730685
UniProtQ04659|CSM3_YEAST Chromosome segregation in meiosis protein 3 (Gene Name=CSM3)

[Back to BioLiP]