Structure of PDB 8j8z Chain L |
>8j8zL (length=107) Species: 10090 (Mus musculus) [Search protein sequence] |
SDIQMTQSPSSLSASVGDRVTITCRASQSVSSAVAWYQQKPGKAPKLLIY SASSLYSGVPSRFSGSRSGTDFTLTISSLQPEDFATYYCQQYKYVPVTFG QGTKVEI |
|
PDB | 8j8z Molecular insights into atypical modes of beta-arrestin interaction with seven transmembrane receptors |
Chain | L |
Resolution | 3.4 Å |
3D structure |
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
peptide |
L |
S31 R67 |
S31 R67 |
|
|
|