Structure of PDB 8j5o Chain L

Receptor sequence

>8j5oL (length=299) Species: 383372 (Roseiflexus castenholzii DSM 13941)

ALPLPSGETLPAASAEVIPFSIIEEFYKRPGKTLAARFFGVDPFDFWIGR
FYVGLFGAISIIGIILGVAFYLYEGVVNEGTLNILAMRIEPPPVSQGLNV
DPAQPGFFWFLTMVAATIAFVGWLLRQIDISLKLDMGMEVPIAFGAVVSS
WITLQWLRPIAMGAWGHGFPLGITHHLDWVSNIGYQYYNFFYNPFHAIGI
TLLFASTLFLHMHGSAVLSEAKRNISDQNIHVFWRNILGYSIGEIGIHRV
AFWTGAASVLFSNLCIFLSGTFVKDWNAFWGFWDKMPIWNGVGQGALVA

3D structure

• PDB: 8j5o Carotenoid assembly regulates quinone diffusion and the Roseiflexus castenholzii reaction center-light harvesting complex architecture.
• Chain: L
• Resolution: 2.9 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	BCL	L	Y87 H192 L193	Y71 H176 L177
BS02	BCL	L	F136 S166 V196 Y201 F206 F207 H212 I216 S278 N279 I282	F120 S150 V180 Y185 F190 F191 H196 I200 S262 N263 I266
BS03	BPH	L	W139 Q143 F160 V163 L187 H192 G271 V275	W123 Q127 F144 V147 L171 H176 G255 V259
BS04	FE	L	H229 H264	H213 H248
BS05	MQE	L	M228 H229 W250 S257 I258 G259	M212 H213 W234 S241 I242 G243
BS06	BPH	L	F220 L224 L254	F204 L208 L238
BS07	MQE	L	I64 F67 A74 I78 R142	I48 F51 A58 I62 R126

Gene Ontology

Molecular Function

• GO:0045156 electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity

Biological Process

• GO:0009772 photosynthetic electron transport in photosystem II
• GO:0019684 photosynthesis, light reaction

Cellular Component

• GO:0030077 plasma membrane light-harvesting complex

External links

• PDB: RCSB:8j5o, PDBe:8j5o, PDBj:8j5o
• PDBsum: 8j5o
• PubMed: 37737710
• UniProt: A7NQE8