Structure of PDB 8iun Chain L

Receptor sequence

>8iunL (length=286) Species: 120962 (Roseiflexus castenholzii)

SAEVIPFSIIEEFYKRPGKTLAARFFGVDPFDFWIGRFYVGLFGAISIIG
IILGVAFYLYEGVVNEGTLNILAMRIEPPPVSQGLNVDPAQPGFFWFLTM
VAATIAFVGWLLRQIDISLKLDMGMEVPIAFGAVVSSWITLQWLRPIAMG
AWGHGFPLGITHHLDWVSNIGYQYYNFFYNPFHAIGITLLFASTLFLHMH
GSAVLSEAKRNISDQNIHVFWRNILGYSIGEIGIHRVAFWTGAASVLFSN
LCIFLSGTFVKDWNAFWGFWDKMPIWNGVGQGALVA

3D structure

• PDB: 8iun New insights on the photocomplex of Roseiflexus castenholzii revealed from comparisons of native and carotenoid-depleted complexes.
• Chain: L
• Resolution: 2.85 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	BPH	L	F220 L224	F191 L195
BS02	MN	L	H229 H264	H200 H235
BS03	MQE	L	F67 V69	F38 V40
BS04	BPH	L	T217 F220	T188 F191
BS05	BCL	L	Y87 W167 F185 H192 L193	Y58 W138 F156 H163 L164
BS06	BCL	L	F136 L170 V196 F206 F207 H212 I216 S278 I282	F107 L141 V167 F177 F178 H183 I187 S249 I253
BS07	BPH	L	I80 W139 F160 V163 G271	I51 W110 F131 V134 G242
BS08	MQE	L	M228 H229 A232 W250 S257 I258 I263	M199 H200 A203 W221 S228 I229 I234

Gene Ontology

Molecular Function

• GO:0016168 chlorophyll binding
• GO:0045156 electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity
• GO:0046872 metal ion binding

Biological Process

• GO:0009772 photosynthetic electron transport in photosystem II
• GO:0015979 photosynthesis
• GO:0019684 photosynthesis, light reaction

Cellular Component

• GO:0016020 membrane
• GO:0030077 plasma membrane light-harvesting complex

External links

• PDB: RCSB:8iun, PDBe:8iun, PDBj:8iun
• PDBsum: 8iun
• PubMed: 37468106
• UniProt: A7NQE8