Structure of PDB 8ie3 Chain L

Receptor sequence

>8ie3L (length=131) Species: 9606 (Homo sapiens) [Search protein sequence]

PSRLRKTRKLRGHVSHGHGGLHHHRINFDKYHPGYFGKVGMKHYHLKRNQ
SFCPTVNLDKLWTLVSEQTRVNAAKNKTGAAPIIDVVRSGYYKVLGKGKL
PKQPVIVKAKFFSRRAEEKIKSVGGACVLVA

3D structure

PDB

8ie3 Visualizing the nucleoplasmic maturation of human pre-60S ribosomal particles.

Chain

Resolution

3.3 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	L	P2 S3 R4 R6 K7 T8 R9 K10 R12 H14 V15 H17 G18 H19 G20 H39 H40 H41 R42 I43 N44 F53 K55 G57 K59 H60 Y61 H62 L63 K64 N66 Q67 N74 L81 V82 S83 Q85 D102 R105 L112 G113 K114 G115 R131 R132	P1 S2 R3 R5 K6 T7 R8 K9 R11 H13 V14 H16 G17 H18 G19 H22 H23 H24 R25 I26 N27 F36 K38 G40 K42 H43 Y44 H45 L46 K47 N49 Q50 N57 L64 V65 S66 Q68 D85 R88 L95 G96 K97 G98 R114 R115

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0005515	protein binding

	Biological Process
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005654	nucleoplasm
GO:0005737	cytoplasm
GO:0005783	endoplasmic reticulum
GO:0005829	cytosol
GO:0005840	ribosome
GO:0015934	large ribosomal subunit
GO:0016020	membrane
GO:0022625	cytosolic large ribosomal subunit
GO:0022626	cytosolic ribosome
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:8ie3, PDBe:8ie3, PDBj:8ie3
PDBsum	8ie3
PubMed	37491604
UniProt	P46776\|RL27A_HUMAN Large ribosomal subunit protein uL15 (Gene Name=RPL27A)