Structure of PDB 8i0q Chain L |
>8i0qL (length=106) Species: 10090 (Mus musculus) [Search protein sequence] |
SDIQMTQSPSSLSASVGDRVTITCRASQSVSSAVAWYQQKPGKAPKLLIY SASSLYSGVPSRFSGSRSGTDFTLTISSLQPEDFATYYCQQYKYVPVTFG QGTKVE |
|
PDB | 8i0q Structure of beta-arrestin in complex with a phosphopeptide |
Chain | L |
Resolution | 4.45 Å |
3D structure |
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
peptide |
L |
S31 R67 |
S31 R67 |
|
|
|