Structure of PDB 8i0p Chain L

Receptor sequence

>8i0pL (length=99) Species: 9606 (Homo sapiens) [Search protein sequence]

VWRNTEDEILKAAVMKYGKNQWSRIASLLHRKSAKQCKARWYEWLDPSIK
KTEWSREEEEKLLHLAKLMPTQWRTIAPIIGRTAAQCLEHYEFLLDKAA

3D structure

PDB

8i0p Molecular Basis for the activation of Human spliceosome

Chain

Resolution

3.4 Å

3D
structure

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	L	N29 S32 H39	N20 S23 H30

Gene Ontology

	Molecular Function
GO:0000977	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0001228	DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0003677	DNA binding
GO:0003723	RNA binding
GO:0005515	protein binding
GO:0042802	identical protein binding
GO:0071987	WD40-repeat domain binding

	Biological Process
GO:0000077	DNA damage checkpoint signaling
GO:0000398	mRNA splicing, via spliceosome
GO:0006281	DNA repair
GO:0006357	regulation of transcription by RNA polymerase II
GO:0006397	mRNA processing
GO:0008380	RNA splicing
GO:0045944	positive regulation of transcription by RNA polymerase II

	Cellular Component
GO:0000974	Prp19 complex
GO:0005634	nucleus
GO:0005654	nucleoplasm
GO:0005662	DNA replication factor A complex
GO:0005681	spliceosomal complex
GO:0005737	cytoplasm
GO:0016020	membrane
GO:0016607	nuclear speck
GO:0071007	U2-type catalytic step 2 spliceosome
GO:0071013	catalytic step 2 spliceosome

External links

PDB	RCSB:8i0p, PDBe:8i0p, PDBj:8i0p
PDBsum	8i0p
PubMed	39068178
UniProt	Q99459\|CDC5L_HUMAN Cell division cycle 5-like protein (Gene Name=CDC5L)