Structure of PDB 8hni Chain L

Receptor sequence

>8hniL (length=178) Species: 9606 (Homo sapiens) [Search protein sequence]

REKEQFRKLFIGGLSFETTEESLRNYYEQWGKLTDCVVMRDPSKRSRGFG
FVTFSSMAEVDAAMAARPHSIDGRVVEPKRAVAREESGKPGAHVTVKKLF
VGGIKEDTEEHHLRDYFEEYGKIDTIEIITDRQSGKKRGFGFVTFDDHDP
VDKIVLQKYHTINGHNAEVRKALSRQEM

3D structure

PDB

8hni Structural Insight Into hnRNP A2/B1 Homodimerization and DNA Recognition.

Chain

Resolution

2.644 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	L	K113 F115 G117 G118 I144 R147 R153 G154 F155 F157 E183 R185 A187 L188 S189 R190 M193	K98 F100 G102 G103 I129 R132 R138 G139 F140 F142 E168 R170 A172 L173 S174 R175 M178
BS02	dna	L	K22 F24 G26 G27 L28 S29 F30 D49 V51 M53 R62 G63 F64 F66 R89 E92 K94 V97 R99 H108	K8 F10 G12 G13 L14 S15 F16 D35 V37 M39 R47 G48 F49 F51 R74 E77 K79 V82 R84 H93

Gene Ontology

	Molecular Function
GO:0003676	nucleic acid binding
GO:0003723	RNA binding

View graph for
Molecular Function

External links

PDB	RCSB:8hni, PDBe:8hni, PDBj:8hni
PDBsum	8hni
PubMed	36528084
UniProt	P22626\|ROA2_HUMAN Heterogeneous nuclear ribonucleoproteins A2/B1 (Gene Name=HNRNPA2B1)

[Back to BioLiP]