Structure of PDB 8gui Chain L

Receptor sequence
>8guiL (length=73) Species: 9606 (Homo sapiens) [Search protein sequence]
ADADEILQEEIKEYKARLTCPCCNTRKKDAVLTKCFHVFCFECVRGRYEA
RQRKCPKCNAAFGAHDFHRIYIS
3D structure
PDB8gui Structure of the human Bre1 complex bound to the nucleosome
ChainL
Resolution2.81 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number 2.3.2.27: RING-type E3 ubiquitin transferase.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 ZN L C963 H965 C983 C986 C35 H37 C55 C58
BS02 ZN L C948 C951 R954 C968 C971 C20 C23 R26 C40 C43
Gene Ontology
Molecular Function
GO:0003730 mRNA 3'-UTR binding
GO:0004842 ubiquitin-protein transferase activity
GO:0005515 protein binding
GO:0016740 transferase activity
GO:0031625 ubiquitin protein ligase binding
GO:0042803 protein homodimerization activity
GO:0046872 metal ion binding
GO:0061630 ubiquitin protein ligase activity
Biological Process
GO:0006325 chromatin organization
GO:0006511 ubiquitin-dependent protein catabolic process
GO:0007346 regulation of mitotic cell cycle
GO:0016567 protein ubiquitination
GO:0045944 positive regulation of transcription by RNA polymerase II
Cellular Component
GO:0000151 ubiquitin ligase complex
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0016020 membrane
GO:0033503 HULC complex
GO:0043005 neuron projection

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8gui, PDBe:8gui, PDBj:8gui
PDBsum8gui
PubMed38519511
UniProtO75150|BRE1B_HUMAN E3 ubiquitin-protein ligase BRE1B (Gene Name=RNF40)

[Back to BioLiP]