Structure of PDB 8ghm Chain L

Receptor sequence
>8ghmL (length=64) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]
ILIDVPLYQADTNDYLDENGQVIFNLSTLIKEKYHLIGKYDVEDPFIDDS
ELLWEEKDGFFVYF
3D structure
PDB8ghm Structure of the Hir histone chaperone complex.
ChainL
Resolution12.0 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide L V596 Y597 F598 V62 Y63 F64
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0031491 nucleosome binding
Biological Process
GO:0000082 G1/S transition of mitotic cell cycle
GO:0006325 chromatin organization
GO:0006334 nucleosome assembly
GO:0006357 regulation of transcription by RNA polymerase II
GO:0006368 transcription elongation by RNA polymerase II
GO:1905268 negative regulation of chromatin organization
Cellular Component
GO:0000417 HIR complex
GO:0005634 nucleus
GO:0005694 chromosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8ghm, PDBe:8ghm, PDBj:8ghm
PDBsum8ghm
PubMed38925115
UniProtQ01448|HPC2_YEAST Histone promoter control protein 2 (Gene Name=HPC2)

[Back to BioLiP]