Structure of PDB 8dbf Chain L

Receptor sequence
>8dbfL (length=316) Species: 9606 (Homo sapiens) [Search protein sequence]
PNIKIFSGSSHQDLSQKIADRLGLELGKVVTKKFSNQETCVEIGESVRGE
DVYIVQSGCGEINDNLMELLIMINACKIASASRVTAVIPCFPYARQDKKD
KSRAPISAKLVANMLSVAGADHIITMDLHASQIQGFFDIPVDNLYAEPAV
LKWIRENISEWRNCTIVSPDAGGAKRVTSIADRLNVDFALIHKERKKANE
VDRMVLVGDVKDRVAILVDDMADTCGTICHAADKLLSAGATRVYAILTHG
IFSGPAISRINNACFEAVVVTNTIPQEDKMKHCSKIQVIDISMILAEAIR
RTHNGESVSYLFSHVP
3D structure
PDB8dbf Human PRPS1 filaments stabilize allosteric sites to regulate activity.
ChainL
Resolution2.2 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number 2.7.6.1: ribose-phosphate diphosphokinase.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 ADP L K100 D101 S103 R104 K99 D100 S102 R103
BS02 ADP L F35 N37 E39 F34 N36 E38
BS03 ADP L R96 Q97 K99 H130 R95 Q96 K98 H129
BS04 HSX L H130 D171 D220 D221 D224 T225 G227 T228 H129 D170 D219 D220 D223 T224 G226 T227
BS05 ADP L D143 Y146 S308 V309 S310 F313 D142 Y145 S307 V308 S309 F312
Gene Ontology
Molecular Function
GO:0000287 magnesium ion binding
GO:0004749 ribose phosphate diphosphokinase activity
GO:0005515 protein binding
GO:0005524 ATP binding
GO:0016301 kinase activity
GO:0042802 identical protein binding
GO:0042803 protein homodimerization activity
GO:0046872 metal ion binding
Biological Process
GO:0006015 5-phosphoribose 1-diphosphate biosynthetic process
GO:0006144 purine nucleobase metabolic process
GO:0006164 purine nucleotide biosynthetic process
GO:0006221 pyrimidine nucleotide biosynthetic process
GO:0006796 phosphate-containing compound metabolic process
GO:0007399 nervous system development
GO:0009156 ribonucleoside monophosphate biosynthetic process
GO:0009165 nucleotide biosynthetic process
GO:0016310 phosphorylation
GO:0034418 urate biosynthetic process
GO:0044249 cellular biosynthetic process
GO:0046101 hypoxanthine biosynthetic process
GO:0090407 organophosphate biosynthetic process
Cellular Component
GO:0002189 ribose phosphate diphosphokinase complex
GO:0005737 cytoplasm
GO:0005829 cytosol

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8dbf, PDBe:8dbf, PDBj:8dbf
PDBsum8dbf
PubMed36747094
UniProtP60891|PRPS1_HUMAN Ribose-phosphate pyrophosphokinase 1 (Gene Name=PRPS1)

[Back to BioLiP]