Structure of PDB 8css Chain L

Receptor sequence

>8cssL (length=161) Species: 9606 (Homo sapiens)

DDPPPSTLLKDYQNVPGIEKVDDVVKRLLSLEMANKKEMLKIKQEQFMKK
IVANPEDTRSLEARIIALSVKIRSYEEHLEKHRKDKAHKRYLLMSIDQRK
KMLKNLRNTNYDVFEKICWGLGIEYTFPPLYYRRAHRRFVTKKALCIRVF
QETQKLKKRRR

3D structure

• PDB: 8css Principles of mitoribosomal small subunit assembly in eukaryotes.
• Chain: L
• Resolution: 2.36 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	L	N99 K100 K101 R123 R128 K135 S138 Y139 H142 K145 H146 R147 K148 D149 K150 H152 K153 R154 Y155 M158 S159 D161 Q162 K165 K168 P192 Y195 Y196 R197 R198 H200 R201 R202 F203 K206 K207 C210 F214 R225	N35 K36 K37 R59 R64 K71 S74 Y75 H78 K81 H82 R83 K84 D85 K86 H88 K89 R90 Y91 M94 S95 D97 Q98 K101 K104 P128 Y131 Y132 R133 R134 H136 R137 R138 F139 K142 K143 C146 F150 R161
BS02	NAD	L	Y195 Y196	Y131 Y132

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0005515 protein binding

Biological Process

• GO:0006412 translation
• GO:0032543 mitochondrial translation

Cellular Component

• GO:0005654 nucleoplasm
• GO:0005730 nucleolus
• GO:0005737 cytoplasm
• GO:0005739 mitochondrion
• GO:0005743 mitochondrial inner membrane
• GO:0005759 mitochondrial matrix
• GO:0005761 mitochondrial ribosome
• GO:0005763 mitochondrial small ribosomal subunit
• GO:0005840 ribosome
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:8css, PDBe:8css, PDBj:8css
• PDBsum: 8css
• PubMed: 36482135
• UniProt: P82914|RT15_HUMAN Small ribosomal subunit protein uS15m (Gene Name=MRPS15)