Structure of PDB 8cgu Chain L

Receptor sequence

>8cguL (length=119) Species: 679895 (Escherichia coli BW25113) [Search protein sequence]

ATVNQLVRKPRAKSNVPALEACPQKRGVCTRVYTTTPKKPNSALRKVCRV
RLTNGFEVTSYIGGEGHNLQEHSVILIRGGRVKDLPGVRYHTVRGALDCS
GVKDRKQARSKYGVKRPKA

3D structure

PDB

8cgu Structural conservation of antibiotic interaction with ribosomes.

Chain

Resolution

1.89 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	L	A2 N5 Q6 L7 R9 R12 A13 K18 A26 C27 P28 Q29 R31 K43 K44 N46 S47 A48 L49 R50 K51 T58 Y66 G68 E70 L81 R83 G84 R86 K88 X89 R94 R110 K111 Q112 A113 R114 S115 K116 G118 V119 K120 R121	A1 N4 Q5 L6 R8 R11 A12 K13 A21 C22 P23 Q24 R26 K38 K39 N41 S42 A43 L44 R45 K46 T53 Y61 G63 E65 L76 R78 G79 R81 K83 X84 R89 R105 K106 Q107 A108 R109 S110 K111 G113 V114 K115 R116

Gene Ontology

	Molecular Function
GO:0000049	tRNA binding
GO:0003735	structural constituent of ribosome
GO:0005515	protein binding
GO:0019843	rRNA binding
GO:0034336	misfolded RNA binding

	Biological Process
GO:0000372	Group I intron splicing
GO:0002181	cytoplasmic translation
GO:0006412	translation
GO:0033120	positive regulation of RNA splicing
GO:0034337	RNA folding
GO:0046677	response to antibiotic
GO:1990145	maintenance of translational fidelity

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0015935	small ribosomal subunit
GO:0022627	cytosolic small ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:8cgu, PDBe:8cgu, PDBj:8cgu
PDBsum	8cgu
PubMed	37550453
UniProt	P0A7S3\|RS12_ECOLI Small ribosomal subunit protein uS12 (Gene Name=rpsL)