Structure of PDB 8cee Chain L

Receptor sequence

>8ceeL (length=136) Species: 224308 (Bacillus subtilis subsp. subtilis str. 168)

PTINQLIRKGRVSKVENSKSPALNKGYNSFKKEHTNVSSPQKRGVCTRVG
TMTPKKPNSALRKYARVRLTNGIEVTAYIPGIGHNLQEHSVVLIRGGRVK
DLPGVRYHIVRGALDTAGVENRAQGRSKYGTKKPKA

3D structure

• PDB: 8cee Structural basis of ribosomal 30S subunit degradation by RNase R
• Chain: L
• Resolution: 3.7 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	L	P2 T3 N5 Q6 L7 R9 R12 V13 S14 K15 N18 S19 S21 L24 N25 N29 F31 S40 P41 Q42 K43 R44 N59 S60 A61 L62 R63 K64 T71 Y79 G82 I83 L94 R96 G97 R99 K101 D102 R107 R123 A124 Q125 G126 R127 S128 K129 Y130 G131 K133 K134	P1 T2 N4 Q5 L6 R8 R11 V12 S13 K14 N17 S18 S20 L23 N24 N28 F30 S39 P40 Q41 K42 R43 N58 S59 A60 L61 R62 K63 T70 Y78 G81 I82 L93 R95 G96 R98 K100 D101 R106 R122 A123 Q124 G125 R126 S127 K128 Y129 G130 K132 K133

Gene Ontology

Molecular Function

• GO:0000049 tRNA binding
• GO:0003735 structural constituent of ribosome
• GO:0005515 protein binding
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation
• GO:0046677 response to antibiotic

Cellular Component

• GO:0005840 ribosome
• GO:0015935 small ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:8cee, PDBe:8cee, PDBj:8cee
• PDBsum: 8cee
• PubMed: 38326618
• UniProt: P21472|RS12_BACSU Small ribosomal subunit protein uS12 (Gene Name=rpsL)