Structure of PDB 8cbn Chain L

Receptor sequence

>8cbnL (length=86) Species: 9606 (Homo sapiens)

MTRDFKPGDLIFAKMKGYPHWPARVDEVPPPTNKLPIFFFGTHETAFLGP
KDIFPYSENKEKYGKPNKRKGFNEGLWEIDNNPKVK

3D structure

• PDB: 8cbn Multivalency of nucleosome recognition by LEDGF.
• Chain: L
• Resolution: 3.34 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	L	K14 M15 K16 G17 Y18 P19 K56 K73 R74	K14 M15 K16 G17 Y18 P19 K51 K68 R69

Gene Ontology

Molecular Function

• GO:0003677 DNA binding
• GO:0003723 RNA binding
• GO:0005515 protein binding
• GO:0097100 supercoiled DNA binding

Biological Process

• GO:0000395 mRNA 5'-splice site recognition
• GO:0006338 chromatin remodeling
• GO:0006979 response to oxidative stress
• GO:0009408 response to heat

Cellular Component

• GO:0000791 euchromatin
• GO:0005634 nucleus
• GO:0005654 nucleoplasm
• GO:0005829 cytosol

External links

• PDB: RCSB:8cbn, PDBe:8cbn, PDBj:8cbn
• PDBsum: 8cbn
• PubMed: 37615563
• UniProt: O75475|PSIP1_HUMAN PC4 and SFRS1-interacting protein (Gene Name=PSIP1)