Structure of PDB 8c87 Chain L

Receptor sequence

>8c87L (length=281) Species: 272943 (Cereibacter sphaeroides 2.4.1)

ALLSFERKYRVPGGTLVGGNLFDFWVGPFYVGFFGVATFFFAALGIILIA
WSAVLQGTWNPQLISVYPPALEYGLGGAPLAKGGLWQIITICATGAFVSW
ALREVEICRKLGIGYHIPFAFAFAILAYLTLVLFRPVMMGAWGYAFPYGI
WTHLDWVSNTGYTYGNFHYNPCHMIAITFFFTNALALALHGALVLSAANP
EKGKEMRTPDHEDTFFRDLVGYSIGTLGIHRLGLLLSLSAVFFSACCMII
TGTIWFDQWVDWWQWWVKLPWWANIPGGING

3D structure

• PDB: 8c87 Stabilization of Cereibacter sphaeroides Photosynthetic Reaction Center by the Introduction of Disulfide Bonds.
• Chain: L
• Resolution: 2.45 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	BCL	L	H168 M174 I177 T178 F181 T182	H168 M174 I177 T178 F181 T182
BS02	BCL	L	F97 A124 A127 V157 T160 F167 H168 H173 I177 F180 S244 M248	F97 A124 A127 V157 T160 F167 H168 H173 I177 F180 S244 M248
BS03	BCL	L	I46 Y128 L131 F146 H153 L154 V157	I46 Y128 L131 F146 H153 L154 V157
BS04	BPH	L	W100 E104 F121 Y148 G149 V241	W100 E104 F121 Y148 G149 V241
BS05	BPH	L	F181 L185 L189	F181 L185 L189
BS06	FE	L	H190 H230	H190 H230

Gene Ontology

Molecular Function

• GO:0042314 bacteriochlorophyll binding
• GO:0045156 electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity
• GO:0046872 metal ion binding

Biological Process

• GO:0009772 photosynthetic electron transport in photosystem II
• GO:0015979 photosynthesis
• GO:0019684 photosynthesis, light reaction

Cellular Component

• GO:0016020 membrane
• GO:0030077 plasma membrane light-harvesting complex
• GO:0042717 plasma membrane-derived chromatophore membrane

External links

• PDB: RCSB:8c87, PDBe:8c87, PDBj:8c87
• PDBsum: 8c87
• PubMed: 36837657
• UniProt: Q3J1A5|RCEL_CERS4 Reaction center protein L chain (Gene Name=pufL)