Structure of PDB 8c7c Chain L

Receptor sequence

>8c7cL (length=281) Species: 272943 (Cereibacter sphaeroides 2.4.1)

ALLSFERKYRVPGGTLVGGNLFDFWVGPFYVGFFGVATFFFAALGIILIA
WSAVLQGTWNPQLISVYPPALEYGLGGAPLAKGGLWQIITICATGAFVSW
ALREVEICRKLGIGYHIPFAFAFAILAYLTLVLFRPVMMGAWGYAFPYGI
WTHLDWVSNTGYTYGNFHYNPAHMIAITFFFTNALALALHGALVLSAANP
EKGKEMRTPDHEDTFFRDLVGYSIGTLGIHRLGLLLSLSAVFFSALCMII
TGTIWFDQWVDWWQWWVKLPWWANIPGCING

3D structure

• PDB: 8c7c Stabilization of Cereibacter sphaeroides Photosynthetic Reaction Center by the Introduction of Disulfide Bonds.
• Chain: L
• Resolution: 2.6 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	BCL	L	F97 A124 I125 L131 V157 F167 H168 H173 I177 S244 M248	F97 A124 I125 L131 V157 F167 H168 H173 I177 S244 M248
BS02	BCL	L	Y128 L131 H153 L154	Y128 L131 H153 L154
BS03	BPH	L	A42 A93 F97 W100 E104 A120 F121 A124 Y148 G149 H153 V241	A42 A93 F97 W100 E104 A120 F121 A124 Y148 G149 H153 V241
BS04	BCL	L	M174 I177 F181 T182	M174 I177 F181 T182
BS05	BPH	L	F181 L185 L189	F181 L185 L189
BS06	FE	L	H190 H230	H190 H230
BS07	U10	L	V31 W100	V31 W100

Gene Ontology

Molecular Function

• GO:0042314 bacteriochlorophyll binding
• GO:0045156 electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity
• GO:0046872 metal ion binding

Biological Process

• GO:0009772 photosynthetic electron transport in photosystem II
• GO:0015979 photosynthesis
• GO:0019684 photosynthesis, light reaction

Cellular Component

• GO:0016020 membrane
• GO:0030077 plasma membrane light-harvesting complex
• GO:0042717 plasma membrane-derived chromatophore membrane

External links

• PDB: RCSB:8c7c, PDBe:8c7c, PDBj:8c7c
• PDBsum: 8c7c
• PubMed: 36837657
• UniProt: Q3J1A5|RCEL_CERS4 Reaction center protein L chain (Gene Name=pufL)