Structure of PDB 8bz1 Chain L

Receptor sequence
>8bz1L (length=44) Species: 9823 (Sus scrofa) [Search protein sequence]
MIYICGECHTENEIKSRDPIRCRECGYRIMYKKRTKRLVVFDAR
3D structure
PDB8bz1 Structural basis of transcription reduction by a promoter-proximal +1 nucleosome.
ChainL
Resolution3.8 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 ZN L C19 C22 C36 C39 C5 C8 C22 C25
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003899 DNA-directed 5'-3' RNA polymerase activity
GO:0008270 zinc ion binding
GO:0046872 metal ion binding
Biological Process
GO:0006351 DNA-templated transcription
GO:0006366 transcription by RNA polymerase II
Cellular Component
GO:0005634 nucleus
GO:0005665 RNA polymerase II, core complex
GO:0005666 RNA polymerase III complex
GO:0005736 RNA polymerase I complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8bz1, PDBe:8bz1, PDBj:8bz1
PDBsum8bz1
PubMed37148879
UniProtA0A4X1TRS6

[Back to BioLiP]